PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g008988m
Common NameCISIN_1g008984mg, LOC102620670, LOC102621667
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 548aa    MW: 61354.3 Da    PI: 5.8074
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g008988mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS420.41.5e-1281775471374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l+++L+ cA+avs+gd + a  l+  l++++s +g+p++Rl ay++e+L+arl  s+s++ykal++++     sse +++++++++++P+ k
  orange1.1g008988m 177 LKQVLIFCAQAVSDGDISTAAGLMRVLEQMVSVSGEPIERLGAYMLEGLRARLEFSGSKIYKALKCEQPV---SSELMSYMSVLFQICPYWK 265
                        5799*****************************************************************8...999999999********** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        f+++ aN  I eave+e+ +HiiDf+i qG+QW+ Ll+aLa+Rp+g+p +RiTg+++++s+  +   l  +g+rL++fA++++vpfef+  +
  orange1.1g008988m 266 FAYMSANVVIGEAVENEHIIHIIDFQIAQGTQWMFLLHALAKRPGGSPLVRITGIDDSQSThaRGGGLDIVGKRLSEFAASCNVPFEFQD-T 356
                        *********************************************************9988889999***********************.8 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a +  ++e ++Lrv+pgEa++Vn+ + lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n+++F++rfle+l+yy+a+f+s++++
  orange1.1g008988m 357 AMTACEVERQHLRVQPGEAVVVNFPFVLHHMPDESVSTENHRDRLLRLVKSLSPKVVTLVEQESKTNTSPFFHRFLETLDYYTAMFESIDVT 448
                        999***************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         pr++++ri+ E+++++r+ivn++aceg er+erhe l+kWr+r+++aGF+p++ls  +++ ++ +l+ ++s+ yrvee++g+l+lgW++r+
  orange1.1g008988m 449 RPRDDKQRISAEQHCVARDIVNMIACEGIERVERHELLGKWRSRFMMAGFTPYRLSPLVTNAVRDVLKDYDSN-YRVEENDGALYLGWRNRA 539
                        ***********************************************************************77.****************** PP

               GRAS 367 LvsvSaWr 374
                        + + SaW+
  orange1.1g008988m 540 MATSSAWK 547
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.7151528IPR005202Transcription factor GRAS
PfamPF035145.2E-126177547IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MQTSQKHQSA ASVQRMYHQP VQGIEPCCLS HVQILDNNIC SDVSSQGTNM SFQTYKEQFY  60
TLDSSTATTG FSHDSPSAVS ISSNRSTFSP QGSQSYQSDP HHSPDNAYGS PMSGSSIVDE  120
GNELRNKLRE LEISLLGPES DIIDSCSCCF KSGTHQDTSA ASWNWDQLME MIPRLDLKQV  180
LIFCAQAVSD GDISTAAGLM RVLEQMVSVS GEPIERLGAY MLEGLRARLE FSGSKIYKAL  240
KCEQPVSSEL MSYMSVLFQI CPYWKFAYMS ANVVIGEAVE NEHIIHIIDF QIAQGTQWMF  300
LLHALAKRPG GSPLVRITGI DDSQSTHARG GGLDIVGKRL SEFAASCNVP FEFQDTAMTA  360
CEVERQHLRV QPGEAVVVNF PFVLHHMPDE SVSTENHRDR LLRLVKSLSP KVVTLVEQES  420
KTNTSPFFHR FLETLDYYTA MFESIDVTRP RDDKQRISAE QHCVARDIVN MIACEGIERV  480
ERHELLGKWR SRFMMAGFTP YRLSPLVTNA VRDVLKDYDS NYRVEENDGA LYLGWRNRAM  540
ATSSAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-581795476375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.58110.0callus| flower| fruit| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467309.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_006475190.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A067GT350.0A0A067GT35_CITSI; Uncharacterized protein
STRINGPOPTR_0016s01110.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13